The domain within your query sequence starts at position 1 and ends at position 155; the E-value for the PP2Cc domain shown below is 4e-87.

AKLTTEEVIKELAQIAGRPTEDEDDKDKVADEDDVDNEEAALLHEEATMTIEELLTRYGQ
NCQKVPPHTKSGIGTGDEPGPQGLNGEAGPEDPSRETPSQENGPTAKGHTGFSSNSEHGT
EAGQISEPGTATGEAGPSCSSASDKLPRVAKSKFF

The domain was found using the schnipsel database

PP2Cc

Serine/threonine phosphatases, family 2C, catalytic domain
PP2Cc
SMART accession number:SM00332
Description: The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.
Family alignment:
View or

There are 66722 PP2Cc domains in 66644 proteins in SMART's nrdb database.

Click on the following links for more information.