The domain within your query sequence starts at position 150 and ends at position 235; the E-value for the S1 domain shown below is 3e-37.

YQDTRGVALVHPLLPGSSTVMVHDLCLAFPAPAKAIIHVSDIQELYVRVVDKVEIGKAVK
AYVRVLDFYKKPFLAKYFTFMDLKLQ

The domain was found using the schnipsel database

S1

Ribosomal protein S1-like RNA-binding domain
S1
SMART accession number:SM00316
Description: -
Interpro abstract (IPR022967):

The S1 domain was originally identified in ribosomal protein S1 but is found in a large number of RNA-associated proteins. The structure of the S1 RNA-binding domain from the Escherichia coli polynucleotide phosphorylase has been determined using NMR methods and consists of a five-stranded antiparallel beta barrel. Conserved residues on one face of the barrel and adjacent loops form the putative RNA-binding site [ (PUBMED:9008164) ].

The structure of the S1 domain is very similar to that of cold shock proteins. This suggests that they may both be derived from an ancient nucleic acid-binding protein [ (PUBMED:9008164) ].

Family alignment:
View or

There are 254322 S1 domains in 154091 proteins in SMART's nrdb database.

Click on the following links for more information.