The domain within your query sequence starts at position 897 and ends at position 933; the E-value for the Sec7 domain shown below is 6e-13.

NVASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPF

The domain was found using the schnipsel database

Sec7

Sec7 domain
Sec7
SMART accession number:SM00222
Description: Domain named after the S. cerevisiae SEC7 gene product, which is required for proper protein transport through the Golgi. The domain facilitates guanine nucleotide exchange on the small GTPases, ARFs (ADP ribosylation factors).
Interpro abstract (IPR000904):

Protein containing this domain are highly divergent in their overall sequence, however, they share a common region of roughly 200 amino acids known as the SEC7 domain. The 3D structure of the domain displays several alpha-helices [(PUBMED:9653114)]. It was found to be associated with other domains involved in guanine nucleotide exchange (e.g., CDC25, Dbl) in mammalian guanine-nucleotide-exchange factors [(PUBMED:9868368)].

SEC7 domain containing proteins are guanine nucleotide exchange factors (GEFs) specific for the ADP-rybosylation factors (ARF), a Ras-like GTPases which is important for vesicular protein trafficking. These proteins can be divided into five families, based on domain organisation and conservation of primary amino acid sequence: GBF/BIG, cytohesins,eFA6, BRAGs, and F-box [(PUBMED:24728583)]. They are found in all eukaryotes, and are involved in membrane remodeling processes throughout the cell [(PUBMED:19669794)].

GO process:regulation of ARF protein signal transduction (GO:0032012)
GO function:ARF guanyl-nucleotide exchange factor activity (GO:0005086)
Family alignment:
View or

There are 12422 Sec7 domains in 12390 proteins in SMART's nrdb database.

Click on the following links for more information.