The domain within your query sequence starts at position 131 and ends at position 210; the E-value for the Tim44 domain shown below is 3e-11.

IWAYFDKEFSIAEFSEGAKQAFAYVSKLLSQCKFDLLEELVAKEVLQILKEKVTSLSDNH
KNALAADIDDIVYTSTGDIS

The domain was found using the schnipsel database

Tim44

Tim44
SMART accession number:SM00978
Description: Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane (PUBMED:10430866). Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group region (PUBMED:10430866).
Interpro abstract (IPR007379):

Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane [ (PUBMED:10430866) ]. Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group region [ (PUBMED:10430866) ]. This entry represents the C-terminal region of Tim44 that has been shown to form a stable proteolytic fragment in yeast. This region is also found in a set of smaller bacterial proteins. The molecular function of the bacterial members is unknown, but transport seems likely. The crystal structure of the C terminus of Tim44 has revealed a large hydrophobic pocket which might play an important role in interacting with the acyl chains of lipid molecules in the mitochondrial membrane [ (PUBMED:16647716) ].

Family alignment:
View or

There are 9767 Tim44 domains in 9757 proteins in SMART's nrdb database.

Click on the following links for more information.