The domain within your query sequence starts at position 28 and ends at position 63; the E-value for the UAS domain shown below is 1e-16.

GVPSVFNPPPARPLQVNTADHRIYSYVVSRPQPRGL

The domain was found using the schnipsel database

UAS

UAS
SMART accession number:SM00594
Description: -
Interpro abstract (IPR006577):

UAS is a domain of unknown function found in FAF1 proteins (FAS-associated factor 1) and in other proteins, many of which are described as having no known function.

Family alignment:
View or

There are 3314 UAS domains in 3305 proteins in SMART's nrdb database.

Click on the following links for more information.