The domain within your query sequence starts at position 1 and ends at position 39; the E-value for the UBA_e1_C domain shown below is 1e-10.

MLLHHQALLYSSGWSSEKQAQHLCLRVAVMNGRIHWKQR

The domain was found using the schnipsel database

UBA_e1_C

Ubiquitin-activating enzyme e1 C-terminal domain
UBA_e1_C
SMART accession number:SM00985
Description: This presumed domain found at the C terminus of Ubiquitin-activating enzyme e1 proteins is functionally uncharacterised.
Interpro abstract (IPR018965):

This domain is found at the C terminus of Ubiquitin-activating enzyme E1 proteins. It binds to E2 enzymes [ (PUBMED:18662542) ].

Family alignment:
View or

There are 2712 UBA_e1_C domains in 2709 proteins in SMART's nrdb database.

Click on the following links for more information.