The domain within your query sequence starts at position 53 and ends at position 109; the E-value for the VWC_def domain shown below is 2e-35.
CVDDSGFVYKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPEC
The domain was found using the schnipsel database
VWC_def |
---|
SMART accession number: | SM00011 |
---|---|
Description: | - |
Family alignment: |
There are 8911 VWC_def domains in 4732 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Metabolism (metabolic pathways involving proteins which contain this domain)