The domain within your query sequence starts at position 138 and ends at position 246; the E-value for the Btz domain shown below is 1.02e-57.

TVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIPRKGLFFEHDLRGQTQEE
EVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYDIRSAHN

Btz

CASC3/Barentsz eIF4AIII binding
Btz
SMART accession number:SM01044
Description: This domain is found on CASC3 (cancer susceptibility candidate gene 3 protein) which is also known as Barentsz (Btz). CASC3 is a component of the EJC (exon junction complex) which is a complex that is involved in post-transcriptional regulation of mRNA in metazoa. The complex is formed by the association of four proteins (eIF4AIII, Barentsz, Mago, and Y14), mRNA, and ATP. This domain wraps around eIF4AIII and stacks against the 5' nucleotide (PUBMED:16923391).
Interpro abstract (IPR018545):

This domain is found on CASC3 (cancer susceptibility candidate gene 3 protein, also known as MLN51) which is also known as Barentsz (Btz). CASC3 is a component of the EJC (exon junction complex) which is a complex that is involved in post-transcriptional regulation of mRNA in metazoa. The complex is formed by the association of four proteins (eIF4AIII, Barentsz, Mago, and Y14), mRNA, and ATP. This domain wraps around eIF4AIII and stacks against the 5' nucleotide [ (PUBMED:16923391) (PUBMED:14973490) ].

Family alignment:
View or

There are 1119 Btz domains in 1117 proteins in SMART's nrdb database.

Click on the following links for more information.