The domain within your query sequence starts at position 345 and ends at position 388; the E-value for the C1_4 domain shown below is 3.13e-21.

FCYGCQGELKDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIH

C1_4

TFIIH C1-like domain
C1_4
SMART accession number:SM01047
Description: The carboxyl-terminal region of TFIIH is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C (PUBMED:10882739).
Interpro abstract (IPR004595):

The carboxyl-terminal region of TFIIH is essential for transcription activity. This regions binds three zinc atoms through two independent domains. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [ (PUBMED:10882739) ].

GO process:DNA repair (GO:0006281)
GO function:zinc ion binding (GO:0008270)
Family alignment:
View or

There are 1283 C1_4 domains in 1282 proteins in SMART's nrdb database.

Click on the following links for more information.