The domain within your query sequence starts at position 345 and ends at position 388; the E-value for the C1_4 domain shown below is 3.13e-21.
FCYGCQGELKDQHVYVCTVCQNVFCVDCDVFVHDSLHCCPGCIH
C1_4TFIIH C1-like domain |
---|
SMART accession number: | SM01047 |
---|---|
Description: | The carboxyl-terminal region of TFIIH is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C (PUBMED:10882739). |
Interpro abstract (IPR004595): | The carboxyl-terminal region of TFIIH is essential for transcription activity. This regions binds three zinc atoms through two independent domains. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [ (PUBMED:10882739) ]. |
GO process: | DNA repair (GO:0006281) |
GO function: | zinc ion binding (GO:0008270) |
Family alignment: |
There are 1283 C1_4 domains in 1282 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)