The domain within your query sequence starts at position 642 and ends at position 717; the E-value for the C8 domain shown below is 1.4e-32.
QIQDKKECGILADPEGPFRECHKLLNPQGAIRDCVYDLCLLPGQSGPLCDALAAYAAACQ AAGGTVHPWRSEELCP
C8 |
---|
SMART accession number: | SM00832 |
---|---|
Description: | This domain contains 8 conserved cysteine residues, but this family only contains 7 of them to overlaps with other domains. It is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin. |
Interpro abstract (IPR014853): | The proteins in this entry contained a domain rich in positionally conserved cysteine residues. Most proteins contains 7 or 8 cysteine residues. The domain is found in disease-related proteins including von Willebrand factor, Alpha tectorin, Zonadhesin and Mucin. It is often found on proteins containing IPR001846 and IPR002919 . |
Family alignment: |
There are 20065 C8 domains in 7663 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Links (links to other resources describing this domain)