The domain within your query sequence starts at position 226 and ends at position 471; the E-value for the CAP10 domain shown below is 7.45e-68.

TLPDLEFYINLGDWPLEHRKVNDTPGPIPIISWCGSLDSRDIILPTYDVTHSTLEAMRGV
TNDLLSVQGNTGPSWINKTEKAFFRGRDSREERLQLVLLSKENPQLLDAGITGYFFFQEK
EKELGKAKLMGFFDFFKYKYQVNVDGTVAAYRYPYLMLGDSLVLKQESPYYEHFYVALKP
WKHYVPIKRNLGDLLEKVKWAKENDEEAKKIAKEGQLTARDLLQPPRLYCYYYRVLQKYA
ERQASK

CAP10

Putative lipopolysaccharide-modifying enzyme.
CAP10
SMART accession number:SM00672
Description: -
Interpro abstract (IPR006598):

The CAP10 domain is found in glycosyltransferases found in animals, plants and fungi. In animals, glucosyltransferases catalyze the transfer of glucose and/or xylose from UDP-glucose and UDP-xylose, respectively, to a serine within the consensus Cys-Xaa-Ser-Xaa-Pro-Cys) in epidermal growth factor repeats, such as those found in coagulation factors F7, F9 and NOTCH proteins. Notch signaling is regulated by Notch glucosylation and glucosylation is required for the correct folding and cleavage of Notch [(PUBMED:18243100), (PUBMED:21490058)].

The pathogenic fungus Cryptococcus neoformans, which most commonly affects the central nervous system and causes fatal meningoencephalitis primarily in patients with AIDS, produces a thick extracellular polysaccharide capsule which is well recognised as a virulence factor. The CAP10 domain is required for capsule formation and virulence [(PUBMED:10482503)]. The capsule is primarily made of two xylose-containing polysaccharides, glucuronoxylomannan and galactoxylomannan, and the glycosyltransferase transfers xylose to alpha-1,3-dimannoside in a beta-1,2-linkage [(PUBMED:17430900)].

Family alignment:
View or

There are 5522 CAP10 domains in 5510 proteins in SMART's nrdb database.

Click on the following links for more information.