The domain within your query sequence starts at position 285 and ends at position 350; the E-value for the CAP_GLY domain shown below is 6.63e-34.
LGDRVVIAGQKVGTLRFCGTTEFASGQWAGIELDEPEGKNNGSVGRVQYFKCAPKYGIFA PLSKIS
CAP_GLY |
---|
SMART accession number: | SM01052 |
---|---|
Description: | Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein Q20728 CAP-Gly domain was recently solved (PUBMED:12221106). The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove (PUBMED:12221106). |
Interpro abstract (IPR000938): | Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved glycine-rich domain, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of the Caenorhabditis elegans F53F4.3 protein CAP-Gly domain has been solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove [ (PUBMED:12221106) ]. |
Family alignment: |
There are 17076 CAP_GLY domains in 12534 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)