The domain within your query sequence starts at position 27 and ends at position 64; the E-value for the CARP domain shown below is 8.74e-12.
CENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRN
CARPDomain in CAPs (cyclase-associated proteins) and X-linked retinitis pigmentosa 2 gene product. |
---|
SMART accession number: | SM00673 |
---|---|
Description: | - |
Interpro abstract (IPR006599): | This entry represents the CARP motif, which occurs as a tandem repeat in the C-terminal of many cyclase-associated proteins (CAPs), as well as in tubulin binding cofactor C and the X-linked retinitis pigmentosa 2 protein (RP2). |
Family alignment: |
There are 9477 CARP domains in 5087 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)