The domain within your query sequence starts at position 287 and ends at position 379; the E-value for the CDC37_C domain shown below is 1.25e-43.
RLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPN SKSGEAKEGEEAGPGDPLLEAVPKAGNEKDVSA
CDC37_CCdc37 C terminal domain |
---|
SMART accession number: | SM01069 |
---|---|
Description: | Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This domains corresponds to the C terminal domain whose function is unclear. It is found C terminal to the Hsp90 chaperone (Heat shocked protein 90) binding domain PF08565 and the N terminal kinase binding domain of Cdc37 (PUBMED:16098195). |
Interpro abstract (IPR013873): | Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This entry corresponds to the C-terminal domain whose function is unclear. It is found C-terminal to the Hsp90 chaperone (heat shock protein 90) binding domain ( IPR013874 ) and the N-terminal kinase binding domain of Cdc37 ( IPR013855 ) [ (PUBMED:16098195) ]. |
Family alignment: |
There are 1390 CDC37_C domains in 1387 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)