The domain within your query sequence starts at position 287 and ends at position 379; the E-value for the CDC37_C domain shown below is 1.25e-43.

RLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPN
SKSGEAKEGEEAGPGDPLLEAVPKAGNEKDVSA

CDC37_C

Cdc37 C terminal domain
CDC37_C
SMART accession number:SM01069
Description: Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This domains corresponds to the C terminal domain whose function is unclear. It is found C terminal to the Hsp90 chaperone (Heat shocked protein 90) binding domain PF08565 and the N terminal kinase binding domain of Cdc37 (PUBMED:16098195).
Interpro abstract (IPR013873):

Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This entry corresponds to the C-terminal domain whose function is unclear. It is found C-terminal to the Hsp90 chaperone (heat shock protein 90) binding domain ( IPR013874 ) and the N-terminal kinase binding domain of Cdc37 ( IPR013855 ) [ (PUBMED:16098195) ].

Family alignment:
View or

There are 1390 CDC37_C domains in 1387 proteins in SMART's nrdb database.

Click on the following links for more information.