The domain within your query sequence starts at position 121 and ends at position 283; the E-value for the CDC37_M domain shown below is 4.37e-84.

SKDGFSKSMVNTKPEKAEEDSEEAREQKHKTFVEKYEKQIKHFGMLHRWDDSQKYLSDNV
HLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTMVMQFILELAKSLKVDPRACFRQFFT
KIKTADHQYMEGFKYELEAFKERVRGRAKLRIEKAMKEYEEEE

CDC37_M

Cdc37 Hsp90 binding domain
CDC37_M
SMART accession number:SM01070
Description: Cdc37 is a molecular chaperone required for the activity of numerous eukaryotic protein kinases. This domains corresponds to the Hsp90 chaperone (Heat shocked protein 90) binding domain of Cdc37 (PUBMED:16098195). It is found between the N terminal Cdc37 domain which is predominantly involved in kinase binding, and the C terminal domain of Cdc37 whose function is unclear.
Interpro abstract (IPR013874):

Cdc37 is a molecular chaperone required for the activity of numerous eukaryotic protein kinases. This entry corresponds to the Hsp90 chaperone (heat shock protein 90) binding domain of Cdc37 [ (PUBMED:16098195) ]. It is found between the N-terminal Cdc37 domain ( IPR013855 ), which is predominantly involved in kinase binding, and the C-terminal domain of Cdc37 ( IPR013873 ) whose function is unclear.

Family alignment:
View or

There are 1781 CDC37_M domains in 1779 proteins in SMART's nrdb database.

Click on the following links for more information.