The domain within your query sequence starts at position 111 and ends at position 183; the E-value for the CDC48_2 domain shown below is 6.22e-7.

PYDTDKMAAEFIQQFNNQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQ
KIEVGLVVGNSQV

CDC48_2

Cell division protein 48 (CDC48) domain 2
CDC48_2
SMART accession number:SM01072
Description: This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains. Both the VAT and NSF N-terminal functional domains consist of two structural domains of which this is at the C-terminus. The VAT-N domain found in AAA ATPases is a substrate 185-residue recognition domain (PUBMED:10531028).
Interpro abstract (IPR004201):

This entry represents the carboxy-terminal subdomain.

The CDC48 N-terminal domain is a protein domain found in AAA ATPases including cell division protein 48 (CDC48), VCP-like ATPase (VAT) and N-ethylmaleimide sensitive fusion protein. It is a substrate recognition domain which binds polypeptides, prevents protein aggregation, and catalyses refolding of permissive substrates. It is composed of two equally sized subdomains. The amino-terminal subdomain forms a double-psi beta-barrel whose pseudo-twofold symmetry is mirrored by an internal sequence repeat of 42 residues. The carboxy-terminal subdomain forms a novel six-stranded beta-clam fold [ (PUBMED:10531028) ]. Together these subdomains form a kidney-shaped structure.

Family alignment:
View or

There are 5666 CDC48_2 domains in 5659 proteins in SMART's nrdb database.

Click on the following links for more information.