The domain within your query sequence starts at position 34 and ends at position 150; the E-value for the CG-1 domain shown below is 8.08e-88.
LPPERLRWNTNEEIASYLITFEKHDEWLSCAPKTRPQNGSIILYNRKKVKYRKDGYLWKK RKDGKTTREDHMKLKVQGMECLYGCYVHSSIVPTFHRRCYWLLQNPDIVLVHYLNVP
CG-1 |
---|
SMART accession number: | SM01076 |
---|---|
Description: | CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein (PUBMED:8075408). CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs (PUBMED:11925432). |
Interpro abstract (IPR005559): | CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite nuclear localisation signal. They are named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [ (PUBMED:8075408) ]. CG-1 domains are found in CAMTA proteins (for CAlModulin -binding Transcription Activator), which are transcription factors containing a calmodulin-binding domain and ankyrin repeats [ (PUBMED:11925432) ]. |
GO function: | DNA binding (GO:0003677) |
Family alignment: |
There are 2235 CG-1 domains in 2230 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Literature (relevant references for this domain)
- Links (links to other resources describing this domain)