The domain within your query sequence starts at position 67 and ends at position 183; the E-value for the CG-1 domain shown below is 1.39e-91.

LPKERHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKDGYCWKK
RKDGKTTREDHMKLKVQGVECLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYLNVP

CG-1

CG-1
SMART accession number:SM01076
Description: CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein (PUBMED:8075408). CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs (PUBMED:11925432).
Interpro abstract (IPR005559):

CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite nuclear localisation signal. They are named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [ (PUBMED:8075408) ]. CG-1 domains are found in CAMTA proteins (for CAlModulin -binding Transcription Activator), which are transcription factors containing a calmodulin-binding domain and ankyrin repeats [ (PUBMED:11925432) ].

GO function:DNA binding (GO:0003677)
Family alignment:
View or

There are 2235 CG-1 domains in 2230 proteins in SMART's nrdb database.

Click on the following links for more information.