The domain within your query sequence starts at position 8 and ends at position 58; the E-value for the CK_II_beta domain shown below is 6.45e-8.
SWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEP
CK_II_betaCasein kinase II regulatory subunit |
---|
SMART accession number: | SM01085 |
---|---|
Description: | - |
Interpro abstract (IPR000704): | Casein kinase, a ubiquitous well-conserved protein kinase involved in cell metabolism and differentiation, is characterised by its preference for Ser or Thr in acidic stretches of amino acids. The enzyme is a tetramer of 2 alpha- and 2 beta-subunits [ (PUBMED:2666134) (PUBMED:1856204) ]. However, some species (e.g., mammals) possess 2 related forms of the alpha-subunit (alpha and alpha'), while others (e.g., fungi) possess 2 related beta-subunits (beta and beta') [ (PUBMED:7737972) ]. The alpha-subunit is the catalytic unit and contains regions characteristic of serine/threonine protein kinases. The beta-subunit is believed to be regulatory, possessing an N-terminal auto-phosphorylation site, an internal acidic domain, and a potential metal-binding motif [ (PUBMED:7737972) ]. The beta subunit contains, in its central section, a cysteine-rich motif, CX(n)C, that could be involved in binding a metal such as zinc [ (PUBMED:8027080) ]. The mammalian beta-subunit gene promoter shares common features with those of other mammalian protein kinases and is closely related to the promoter of the regulatory subunit of cAMP-dependent protein kinase [ (PUBMED:7737972) ]. |
GO component: | protein kinase CK2 complex (GO:0005956) |
GO function: | protein kinase regulator activity (GO:0019887) |
Family alignment: |
There are 3104 CK_II_beta domains in 3099 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)