The domain within your query sequence starts at position 668 and ends at position 808; the E-value for the CLECT domain shown below is 2.71e-30.

CPQGWVSDPKLRHCYKVFSSERLQEKKSWIQALGVCRELGAQLLSLASYEEEHFVAHMLN
KIFGESEPESHEQHWFWIGLNRRDPREGHSWRWSDGLGFSYHNFARSRHDDDDIRGCAVL
DLASLQWVPMQCQTQLDWICK

CLECT

C-type lectin (CTL) or carbohydrate-recognition domain (CRD)
CLECT
SMART accession number:SM00034
Description: Many of these domains function as calcium-dependent carbohydrate binding modules.
Interpro abstract (IPR001304):

A number of different families of proteins share a conserved domain which was first characterized in some animal lectins and which seem to function as a calcium-dependent carbohydrate-recognition domain [(PUBMED:3290208), (PUBMED:8341801)]. This domain, which is known as the C-type lectin domain (CTL) or as the carbohydrate-recognition domain (CRD), consists of about 110 to 130 residues. There are four cysteines which are perfectly conserved and involved in two disulfide bonds.

There are proteins with modules similar in overall structure to CRDs that serve functions other than sugar binding. Therefore, a more general term C-type lectin-like domain was introduced to refer to such domains, although both terms C-type lectin and C-type lectin-like are sometimes used interchangeably [(PUBMED:16336259)].

C-type lectins can be further divided into seven subgroups based on additional non-lectin domains and gene structure: (I) hyalectans, (II) asialoglycoprotein receptors, (III) collectins, (IV) selectins, (V) NK group transmembrane receptors, (VI) macrophage mannose receptors, and (VII) simple (single domain) lectins [(PUBMED:15476922)]. Lectins are a diverse group of proteins, both in terms of structure and activity. Carbohydrate binding ability may have evolved independently and sporadically in numerous unrelated families, where each evolved a structure that was conserved to fulfil some other activity and function. In general, animal lectins act as recognition molecules within the immune system, their functions involving defence against pathogens, cell trafficking, immune regulation and the prevention of autoimmunity [(PUBMED:14519388)].

Family alignment:
View or

There are 74207 CLECT domains in 53821 proteins in SMART's nrdb database.

Click on the following links for more information.