The domain within your query sequence starts at position 839 and ends at position 962; the E-value for the CPSase_L_D3 domain shown below is 1.18e-57.

LKKELSEPSSTRIYAIAKALENNMSLDEIVRLTSIDKWFLYKMRDILNMDKTLKGLNSDS
VTEETLRKAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYL
YVTY

CPSase_L_D3

Carbamoyl-phosphate synthetase large chain, oligomerisation domain
CPSase_L_D3
SMART accession number:SM01096
Description: Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain.
Interpro abstract (IPR005480):

This entry represents the oligomerisation domain found in the large subunit of carbamoyl phosphate synthases as well as in certain other carboxy phosphate domain-containing enzymes. This domain forms a primarily alpha-helical fold [ (PUBMED:10089390) ].

Family alignment:
View or

There are 32225 CPSase_L_D3 domains in 32224 proteins in SMART's nrdb database.

Click on the following links for more information.