The domain within your query sequence starts at position 18 and ends at position 135; the E-value for the CSF2 domain shown below is 2.1e-69.

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFE
QGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFEC

CSF2

Granulocyte-macrophage colony-simulating factor (GM-CSF)
CSF2
SMART accession number:SM00040
Description: GM-CSF stimulates the development of and the cytotoxic activity of white blood cells.
Interpro abstract (IPR000773):

Granulocyte-macrophage colony-stimulating factor (GMCSF) is a cytokine that acts in hematopoiesis to stimulate growth and differentiation of hematopoietic precursor cells from various lineages including granulocytes, macrophages, eosinophils and erythrocytes [ (PUBMED:2458827) (PUBMED:1569568) ]. GMCSF is a glycoprotein of ~120 residues that contains 4 conserved cysteines that participate in disulphide bond formation. The crystal structure of recombinant human GMCSF has been determined [ (PUBMED:1569568) ]. There are two molecules in the asymmetric unit, which are related by an approximate non-crystallographic 2-fold axis. The overall structure, which is highly compact and globular with a predominantly hydrophobic core, is characterised by a 4-alpha-helix bundle. The helices are arranged in a left-handed anti-parallel fashion, with two overhand connections. Within the connections is a two-stranded anti-parallel beta-sheet. The tertiary structure has a topology similar to that of Sus scrofa (pig) growth factor and interferon-beta. Most of the proposed critical regions for receptor binding are located on a continuous surface at one end of the molecule that includes the C terminus [ (PUBMED:1569568) ].

GO process:immune response (GO:0006955)
GO component:extracellular region (GO:0005576)
GO function:granulocyte macrophage colony-stimulating factor receptor binding (GO:0005129), growth factor activity (GO:0008083)
Family alignment:
View or

There are 76 CSF2 domains in 76 proteins in SMART's nrdb database.

Click on the following links for more information.