The domain within your query sequence starts at position 766 and ends at position 902; the E-value for the CTD domain shown below is 2.09e-31.

GSQTPMYGSGSRTPMYGSQTPLQDGSRTPHYGSQTPLHDGSRTPAQSGAWDPNNPNTPSR
AEEEYEYAFDDEPTPSPQAYGGTPNPQTPGYPDPSSPQVNPQYNPQTPGTPAMYNTDQFS
PYAAPSPQGSYQPSPSP

CTD

Spt5 C-terminal nonapeptide repeat binding Spt4
CTD
SMART accession number:SM01104
Description: The C-terminal domain of the transcription elongation factor protein Spt5 is necessary for binding to Spt4 to form the functional complex that regulates early transcription elongation by RNA polymerase II. The complex may be involved in pre-mRNA processing through its association with mRNA capping enzymes. This CTD domain carries a regular nonapeptide repeat that can be present in up to 18 copies, as in S. pombe (PUBMED:19460865). The repeat has a characteristic TPA motif.
Interpro abstract (IPR024945):

The C-terminal domain of the transcription elongation factor protein Spt5 is necessary for binding to Spt4 to form the functional complex that regulates early transcription elongation by RNA polymerase II. The complex may be involved in pre-mRNA processing through its association with mRNA capping enzymes. This CTD domain carries a regular nonapeptide repeat that can be present in up to 18 copies, as in S. pombe [ (PUBMED:19460865) ]. The repeat has a characteristic TPA motif.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 1111 CTD domains in 1071 proteins in SMART's nrdb database.

Click on the following links for more information.