The domain within your query sequence starts at position 28 and ends at position 129; the E-value for the CY domain shown below is 1.05e-2.

QRPLSPLHPLGCNDSEVLAVAGFALQNINRDQKDGYMLSLNRVHDVREHYQEDMGSLFYL
TLDVLETDCHVLSRKAQKDCKPRMFYESVYGQCKAMFHINKP

CY

Cystatin-like domain
CY
SMART accession number:SM00043
Description: Cystatins are a family of cysteine protease inhibitors that occur mainly as single domain proteins. However some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.
Interpro abstract (IPR000010):

Cystatins are a family of cysteine protease inhibitors belonging to MEROPS inhibitor family I25, clan IH [ (PUBMED:2107324) (PUBMED:14587292) (PUBMED:1855589) ]. They mainly inhibit peptidases belonging to peptidase families C1 (papain family) and C13 (legumain family). They occur mainly as single domain proteins. However, some extracellular proteins such as kininogen, His-rich glycoprotein and fetuin also contain these domains.

GO function:cysteine-type endopeptidase inhibitor activity (GO:0004869)
Family alignment:
View or

There are 9885 CY domains in 7379 proteins in SMART's nrdb database.

Click on the following links for more information.