The domain within your query sequence starts at position 363 and ends at position 565; the E-value for the CYCc domain shown below is 3.16e-63.

WARNING!
Some of the required catalytic sites were not detected in this domain. It is probably inactive! Check the literature (PubMed 97222132 ) for details.

Catalytic residues
PositionAmino acidPresent?
DomainProtein
171533NNo
175537RNo
TENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFT
NLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCCVE
MGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG
IPGRIHISKATLDCLNGDYNVEE

CYCc

Adenylyl- / guanylyl cyclase, catalytic domain
CYCc
SMART accession number:SM00044
Description: Present in two copies in mammalian adenylyl cyclases. Eubacterial homologues are known. Two residues (Asn, Arg) are thought to be involved in catalysis. These cyclases have important roles in a diverse range of cellular processes.
Interpro abstract (IPR001054):

Guanylate cyclases (EC 4.6.1.2) catalyse the formation of cyclic GMP (cGMP) from GTP. cGMP acts as an intracellular messenger, activating cGMP-dependent kinases and regulating cGMP-sensitive ion channels. The role of cGMP as a second messenger in vascular smooth muscle relaxation and retinal photo-transduction is well established. Guanylate cyclase is found both in the soluble and particulate fractions of eukaryotic cells. The soluble and plasma membrane-bound forms differ in structure, regulation and other properties [(PUBMED:1349465), (PUBMED:1356629), (PUBMED:1680765), (PUBMED:1982420)]. Most currently known plasma membrane-bound forms are receptors for small polypeptides. The soluble forms of guanylate cyclase are cytoplasmic heterodimers having alpha and beta subunits.

In all characterised eukaryote guanylyl- and adenylyl cyclases, cyclic nucleotide synthesis is carried out by the conserved class III cyclase domain.

GO process:intracellular signal transduction (GO:0035556), cyclic nucleotide biosynthetic process (GO:0009190)
GO function:phosphorus-oxygen lyase activity (GO:0016849)
Family alignment:
View or

There are 67904 CYCc domains in 62634 proteins in SMART's nrdb database.

Click on the following links for more information.