The domain within your query sequence starts at position 5 and ends at position 200; the E-value for the CYTH domain shown below is 1.29e-13.

LIEVERKFAPGPDTEERLQELGATLEHRVTFRDTYYDTSELSLMLSDHWLRQREGSGWEL
KCPGVTGVSGPHNEYVEVTSEAAIVAQLFELLGSGEQKPAGVAAVLGSLKLQEVASFITT
RSSWKLALSGAHGQEPQLTIDLDSADFGYAVGEVEAMVHEKAEVPAALEKIITVSSMLGV
PAQEEAPAKLMVYLQR

CYTH

CYTH
SMART accession number:SM01118
Description: These sequences are functionally identified as members of the adenylate cyclase family, which catalyses the conversion of ATP to 3',5'-cyclic AMP and pyrophosphate. Six distinct non-homologous classes of AC have been identified. The structure of three classes of adenylyl cyclases have been solved ((PUBMED:16905149)).
Interpro abstract (IPR023577):

The entry represents the CYTH domain. The bacterial CyaB like adenylyl cyclase and the mammalian thiamine triphosphatases (ThTPases) define a superfamily of catalytic domains called the CYTH (CyaB, thiamine triphosphatase) domain that is present in all three superkingdoms of life [ (PUBMED:22984449) ]. Proteins containing this domain act on triphosphorylated substrates and require at least one divalent metal cation for catalysis [ (PUBMED:24021036) ].

The catalytic core of the CYTH domain is predicted to contain an alpha+beta scaffold with 6 conserved beta-strands and 6 conserved alpha-helices. The CYTH domains contains several nearly universally conserved charged residues that are likely to form the active site. The most prominent of these are an EXEXK motif associated with strand-1 of the domain, two basic residues in helix-2, a K at the end of strand 3, an E in strand 4, a basic residue in helix-4, a D at the end of strand 5 and two acidic residues (typically glutamates) in strand 6. The presence of around 6 conserved acidic positions in the majority of the CYTH domains suggests that it coordinates two divalent metal ions. Both CyaB and ThTPase have been shown to require Mg(2+) ions for their nucleotide cyclase and phosphatase activities. The four conserved basic residues in the CYTH domain are most probably involved in the binding of acidic phosphate moieties of their substrates. The conservation of these two sets of residues in the majority of CYTH domains suggests that most members of this group are likely to possess an activity dependent on two metal ions, with a preference for nucleotides or related phosphate-moiety -bearing substrates. The proposed biochemical activity, and the arrangement of predicted strands in the primary structure of the CYTH domain imply that they may adopt a barrel or sandwich- like configuration, with metal ions and the substrates bound in the central cavity [ (PUBMED:12456267) ].

Family alignment:
View or

There are 17696 CYTH domains in 17691 proteins in SMART's nrdb database.

Click on the following links for more information.