The domain within your query sequence starts at position 382 and ends at position 461; the E-value for the CaMBD domain shown below is 1.99e-46.

DTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQGRVRKHQRKFLQAIHQAQKLRSVKIE
QGKVNDQANTLAELAKAQSI

CaMBD

Calmodulin binding domain
CaMBD
SMART accession number:SM01053
Description: Small-conductance Ca2+-activated K+ channels (SK channels) are independent of voltage and gated solely by intracellular Ca2+. These membrane channels are heteromeric complexes that comprise pore-forming alpha-subunits and the Ca2+-binding protein calmodulin (CaM) (PUBMED:11323678). CaM binds to the SK channel through this the CaM-binding domain (CaMBD), which is located in an intracellular region of the alpha-subunit immediately carboxy-terminal to the pore. Channel opening is triggered when Ca2+ binds the EF hands in the N-lobe of CaM. The structure of this domain complexed with CaM is known (PUBMED:11323678). This domain forms an elongated dimer with a CaM molecule bound at each end; each CaM wraps around three alpha-helices, two from one CaMBD subunit and one from the other.
Interpro abstract (IPR004178):

Small-conductance Ca2+-activated K+ channels (SK channels) are independent of voltage and gated solely by intracellular Ca2+. These membrane channels are heteromeric complexes that comprise pore-forming alpha-subunits and the Ca2+-binding protein calmodulin (CaM) [ (PUBMED:11323678) ]. CaM binds to the SK channel through this the CaM-binding domain (CaMBD), which is located in an intracellular region of the alpha-subunit immediately carboxy-terminal to the pore. Channel opening is triggered when Ca2+ binds the EF hands in the N-lobe of CaM. The structure of this domain complexed with CaM is known [ (PUBMED:11323678) ]. This domain forms an elongated dimer with a CaM molecule bound at each end; each CaM wraps around three alpha-helices, two from one CaMBD subunit and one from the other.

GO process:potassium ion transport (GO:0006813)
GO component:integral component of membrane (GO:0016021)
GO function:calcium-activated potassium channel activity (GO:0015269), calmodulin binding (GO:0005516)
Family alignment:
View or

There are 1789 CaMBD domains in 1786 proteins in SMART's nrdb database.

Click on the following links for more information.