The domain within your query sequence starts at position 115 and ends at position 177; the E-value for the ChSh domain shown below is 6.46e-34.

RGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTW
HSC

ChSh

Chromo Shadow Domain
ChSh
SMART accession number:SM00300
Description: -
Interpro abstract (IPR008251):

Chromo shadow domain is distantly related to chromo domain. It is always found in association with a chromo domain.

The CHROMO (CHRromatin Organization MOdifier) domain [ (PUBMED:1982376) (PUBMED:1708124) (PUBMED:7667093) (PUBMED:7501439) ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation. These are proteins that alter the structure of chromatin to the condensed morphology of heterochromatin, a cytologically visible condition where gene expression is repressed. In one of these proteins, Polycomb, the chromo domain has been shown to be important for chromatin targeting. Proteins that contain a chromo domain appear to fall into 3 classes. The first class includes proteins having an N-terminal chromo domain followed by a region termed the chromo shadow domain [ (PUBMED:7667093) ], eg. Drosophila and human heterochromatin protein Su(var)205 (HP1); and mammalian modifier 1 and modifier 2. The second class includes proteins with a single chromo domain, eg. Drosophila protein Polycomb (Pc); mammalian modifier 3; human Mi-2 autoantigenand and several yeast and Caenorhabditis elegans hypothetical proteins. In the third class paired tandem chromo domains are found, eg. in mammalian DNA-binding/helicase proteins CHD-1 to CHD-4 and yeast protein CHD1.

GO component:nucleus (GO:0005634)
Family alignment:
View or

There are 1565 ChSh domains in 1560 proteins in SMART's nrdb database.

Click on the following links for more information.