The domain within your query sequence starts at position 51 and ends at position 147; the E-value for the CoA_binding domain shown below is 6.28e-35.

YIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGLPVFNTVKEAKEK
TGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGI

CoA_binding

CoA binding domain
CoA_binding
SMART accession number:SM00881
Description: This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.
Interpro abstract (IPR003781):

This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases.

Family alignment:
View or

There are 47705 CoA_binding domains in 47704 proteins in SMART's nrdb database.

Click on the following links for more information.