The domain within your query sequence starts at position 786 and ends at position 868; the E-value for the DAX domain shown below is 5.92e-45.

CDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEE
VREDEAVLPVFEEKIIGKVEKVD

DAX

Domain present in Dishevelled and axin
DAX
SMART accession number:SM00021
Description: Domain of unknown function.
Interpro abstract (IPR001158):

A third type of DIX domain-possessing protein, known as Coiled-coil-DIX1 (Ccd1) or Dixin, forms homomeric and heteromeric complexes with Dvl and Axin and is positive regulator of Wnt signaling [ (PUBMED:15857680) ].

Proteins of the dishevelled family (Dsh and Dvl) play a key role in the transduction of the Wg/Wnt signal from the cell surface to the nucleus: in response to Wnt signal, they block the degradation of beta- catenin by interacting with the scaffolding protein axin. The N terminus of proteins of the dishevelled family and the C terminus of proteins of the axin family share a region of homology of about 85 amino acids, which has been called DIX for DIshevelled and aXin [ (PUBMED:9407023) ]. The DIX domain is found associated with PDZ and DEP domains in proteins of the dishevelled family and with an RGS domain in proteins of the axin family. DIX has been shown to be a protein-protein interaction domain that is important for homo- and hetero-oligomerization of proteins of the dishevelled and axin families [ (PUBMED:10330181) (PUBMED:10318824) (PUBMED:11041490) (PUBMED:11027605) ]. The DIX domain has also be shown to be a signalling module that can target proteins to actin stress fibres and cytoplasmic vesicles to control Wnt signalling [ (PUBMED:12384700) ].

The Dvl2 DIX domain has been shown to form a predominantly helical structure [ (PUBMED:12384700) ].

Family alignment:
View or

There are 1668 DAX domains in 1662 proteins in SMART's nrdb database.

Click on the following links for more information.