The domain within your query sequence starts at position 605 and ends at position 669; the E-value for the DDT domain shown below is 5.59e-17.

NTLFGDVALVVEFLSCYSGLLLPDAQYPITAVSLMEALSADKGGFLYLNRVLVILLQTLL
QDEIA

DDT

domain in different transcription and chromosome remodeling factors
DDT
SMART accession number:SM00571
Description: -
Interpro abstract (IPR018501):

The DDT has been named after the better characterised DNA-binding homeobox- containing proteins and the Different Transcription and chromatin remodelling factors in which it is found. It is a domain of about 60 amino acids which is exclusively associated with nuclear domains like AT-Hook, PHD finger, methyl-CpG-binding domain, bromodomain and DNA-binding homeodomain.

The DDT domain is characterised by a number of conserved aromatic and charged residues and is predicted to consist of three alpha helices. A DNA-binding function for the DDT domain has been proposed [(PUBMED:11246006)].

Family alignment:
View or

There are 3151 DDT domains in 3146 proteins in SMART's nrdb database.

Click on the following links for more information.