The domain within your query sequence starts at position 7 and ends at position 304; the E-value for the DHDPS domain shown below is 1.29e-72.

KLRGLVAATITPMTENGEINFPVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQV
AEEWVNQGRNKLDQVVIHVGALNVKESQELAQHAAEIGADGIAVIAPFFFKSQNKDALIS
FLREVAAAAPTLPFYYYHMPSMTGVKIRAEELLDGIQDKIPTFQGLKFTDTDLLDFGQCV
DQNHQRQFALLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDLASALSYQ
FRIQRFINYVIKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKATQEFTAKAEAKLKSLD

DHDPS

Dihydrodipicolinate synthetase family
DHDPS
SMART accession number:SM01130
Description: This family has a TIM barrel structure. This enzyme belongs to the family of lyases, specifically the hydro-lyases, which cleave carbon-oxygen bonds.
Interpro abstract (IPR002220):

Dihydrodipicolinate synthase (EC 4.2.1.52) (DHDPS, DapA) catalyses, in higher plants, some fungi and bacteria (gene dapA), the first reaction specific to the biosynthesis of lysine and of diaminopimelate [(PUBMED:22949190)]. DHDPS is responsible for the condensation of aspartate semialdehyde and pyruvate by a ping-pong mechanism in which pyruvate first binds to the enzyme by forming a Schiff-base with a lysine residue [(PUBMED:1463470), (PUBMED:20025926)].

Other proteins are structurally related to DHDPS and probably also act via a similar catalytic mechanism [(PUBMED:9047371)]:

  • Escherichia coli N-acetylneuraminate lyase (EC 4.1.3.3) (gene nanA), which catalyses the condensation of N-acetyl-D-mannosamine and pyruvate to form N-acetylneuraminate.
  • Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase.
  • D-4-deoxy-5-oxoglucarate dehydratase.
  • Rhizobium meliloti protein mosA [(PUBMED:8349559)], which is involved in the biosynthesis of the rhizopine 3-o-methyl-scyllo-inosamine.
  • Thermoproteus tenax 2-dehydro-3-deoxy-D-gluconate/2-dehydro-3-deoxy-phosphogluconate aldolase (KdgA) [(PUBMED:18186475)].
GO process:metabolic process (GO:0008152)
GO function:lyase activity (GO:0016829)
Family alignment:
View or

There are 57397 DHDPS domains in 57392 proteins in SMART's nrdb database.

Click on the following links for more information.