The domain within your query sequence starts at position 487 and ends at position 545; the E-value for the DM14 domain shown below is 4.62e-27.
LAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNGLPVDIAKVPPAP
DM14Repeats in fly CG4713, worm Y37H9A.3 and human FLJ20241. |
---|
SMART accession number: | SM00685 |
---|---|
Description: | - |
Interpro abstract (IPR006608): | This domain is found, sometimes in multiple copies, in proteins whose functions have not been characterised. |
Family alignment: |
There are 3682 DM14 domains in 975 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)