The domain within your query sequence starts at position 23 and ends at position 87; the E-value for the DM3 domain shown below is 6.96e-21.

FHRFPFSRPELLREWVLNIGRADFKPKQHTVICSEHFRPECFSAFGNRKNLKHNAVPTVF
AFQNP

DM3

Zinc finger domain in CG10631, C. elegans LIN-15B and human P52rIPK.
DM3
SMART accession number:SM00692
Description: -
Interpro abstract (IPR006612):

The THAP-type zinc finger (consensus: C-x(2,4)-C-x(35,50)-C-x(2)-H) is an ~90-residue domain restricted to animals, which is shared between the THAP family of cellular DNA-binding proteins, and transposases from mobile genomic parasites [(PUBMED:12575992), (PUBMED:12717420)]. THAP1, the prototype of the THAP family, possesses zinc-dependent sequence-specific DNA binding activity and recognizes a consensus DNA target sequence of 11 nucleotides [(PUBMED:15863623)]. The THAP-type zinc finger can be found in one or more copies and can be associated with other domains, such as the C2H2-type zinc finger.

The structure of the THAP-type zinc finger reveals the presence between the C2CH zinc coordinating residues of a short antiparallel beta-sheet interspersed by a long loop-helix-loop insertion. This loop-helix-loop motif has been shown to be essential for the identification of a number of critical residues for DNA recognition [(PUBMED:18073205)].

GO function:nucleic acid binding (GO:0003676)
Family alignment:
View or

There are 9531 DM3 domains in 7798 proteins in SMART's nrdb database.

Click on the following links for more information.