The domain within your query sequence starts at position 12 and ends at position 130; the E-value for the DMAP_binding domain shown below is 7.4e-47.

AVAALPPEVRAQLAELELELSEGDITQKGYEKKRSKLLSPYSPQTQETDSIGQKERNQTP
APTAAQTSAPSKYHRSRSGGARDERYRSDIHTEAVQAALAKHKEQKMALPMPTKRRSTF

DMAP_binding

DMAP1-binding Domain
DMAP_binding
SMART accession number:SM01137
Description: This domain binds DMAP1, a transcriptional co-repressor.
Interpro abstract (IPR010506):

This domain binds DMAP1, a transcriptional co-repressor. It is found, among other proteins, at the N terminus of DNMT1 (DNA methyltransferase 1) [ (PUBMED:10888872) ].

Family alignment:
View or

There are 2493 DMAP_binding domains in 2490 proteins in SMART's nrdb database.

Click on the following links for more information.