The domain within your query sequence starts at position 33 and ends at position 121; the E-value for the DRY_EERY domain shown below is 1.8e-30.

VELLVFGYACKLFRDDERALAQEQGQHLIPWMGDPKILIDRYDGRGHLHDLSAYDAEYAT
WNRDYQLSEEEARVEALCDEERGRIQKIE

DRY_EERY

Alternative splicing regulator
DRY_EERY
SMART accession number:SM01141
Description: This entry represents the conserved N-terminal region of SWAP (suppressor-of-white-apricot protein) proteins. This region contains two highly conserved motifs, viz: DRY and EERY, which appear to be the sites for alternative splicing of exons 2 and 3 of the SWAP mRNA [(PUBMED:8206918)]. These proteins are thus thought to be involved in auto-regulation of pre-mRNA splicing. Most family members are associated with two SWAP (Surp) domains SM00648 and an Arginine- serine-rich binding region towards the C-terminus.
Interpro abstract (IPR019147):

This entry represents the conserved N-terminal region of SWAP (suppressor-of-white-apricot protein) splice factor proteins. This region contains two highly conserved motifs, viz: DRY and EERY, which appear to be the sites for alternative splicing of exons 2 and 3 of the SWAP mRNA [ (PUBMED:8206918) ]. These proteins are thus thought to be involved in auto-regulation of pre-mRNA splicing.

Family alignment:
View or

There are 1975 DRY_EERY domains in 1973 proteins in SMART's nrdb database.

Click on the following links for more information.