The domain within your query sequence starts at position 65 and ends at position 293; the E-value for the DTW domain shown below is 2.33e-58.
RMFYCYTCCVPVGNVPTEQIPCVQLPLKIDIIKHPNETDGKSTAVHAKLLAPDSVNIYTY PCIPEYEGKDHEVVLVFPGPQSISIEDVSFHLQKRIESKGRNKADNLDVPPRKLKRTTDE EGWDLHESTRQGPELKRVVFIDSTWSQTNQIASDERLRELLQVELRTRKTCFWRHQKGKP DTFLSTIEAIYYFLVDYHSAVQKEKYRGQYDNLLFFYSFMYRLIKNARG
DTW |
---|
SMART accession number: | SM01144 |
---|---|
Description: | This presumed domain is found in bacterial and eukaryotic proteins. Its function is unknown. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after. |
Interpro abstract (IPR005636): | This presumed domain is found DTWD1/DTWD2 from humans and YfiP (also known as TapT) from Escherichia coli. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after. DTW domain containing protein may have a SAM-dependent acp transferase activity [ (PUBMED:31863583) ]. |
Family alignment: |
There are 7401 DTW domains in 7399 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)