The domain within your query sequence starts at position 65 and ends at position 293; the E-value for the DTW domain shown below is 2.33e-58.

RMFYCYTCCVPVGNVPTEQIPCVQLPLKIDIIKHPNETDGKSTAVHAKLLAPDSVNIYTY
PCIPEYEGKDHEVVLVFPGPQSISIEDVSFHLQKRIESKGRNKADNLDVPPRKLKRTTDE
EGWDLHESTRQGPELKRVVFIDSTWSQTNQIASDERLRELLQVELRTRKTCFWRHQKGKP
DTFLSTIEAIYYFLVDYHSAVQKEKYRGQYDNLLFFYSFMYRLIKNARG

DTW

DTW
SMART accession number:SM01144
Description: This presumed domain is found in bacterial and eukaryotic proteins. Its function is unknown. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after.
Interpro abstract (IPR005636):

This presumed domain is found DTWD1/DTWD2 from humans and YfiP (also known as TapT) from Escherichia coli. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after. DTW domain containing protein may have a SAM-dependent acp transferase activity [ (PUBMED:31863583) ].

Family alignment:
View or

There are 7401 DTW domains in 7399 proteins in SMART's nrdb database.

Click on the following links for more information.