The domain within your query sequence starts at position 1345 and ends at position 1409; the E-value for the DUF1087 domain shown below is 2.98e-33.
VREEDKIEEIEREIIKQEENVDPDYWEKLLRHHYEQQQEDLARNLGKGKRVRKQVNYNDA AQEDQ
DUF1087 |
---|
SMART accession number: | SM01147 |
---|---|
Description: | Members of this family are found in various chromatin remodelling factors and transposases. Their exact function is, as yet, unknown. |
Interpro abstract (IPR009463): | This domain is found in various chromatin remodelling factors. Its function is, as yet, unknown. |
Family alignment: |
There are 2152 DUF1087 domains in 2147 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Links (links to other resources describing this domain)