The domain within your query sequence starts at position 1218 and ends at position 1274; the E-value for the DUF1518 domain shown below is 1.14e-11.

NMGGQFGAGISPQMQQNVFQYPGPGLVPQGEATFAPSLSPGSSMVPMPVPPPQSSLL

DUF1518

DUF1518
SMART accession number:SM01151
Description: This domain, which is usually found tandemly repeated, is found various receptor co-activating proteins.
Interpro abstract (IPR010011):

This domain, which is usually found tandemly repeated, is found various receptor co-activating proteins.

GO component:nucleus (GO:0005634)
Family alignment:
View or

There are 1581 DUF1518 domains in 1234 proteins in SMART's nrdb database.

Click on the following links for more information.