The domain within your query sequence starts at position 32 and ends at position 108; the E-value for the DUF167 domain shown below is 3.17e-28.
PKGFVTIAIHAKPGSRQNAVTDLSTEAVGVAIAAPPSEGEANAELCRYLSKVLDLRKSDV VLDKGGKSREKVVKLLA
DUF167 |
---|
SMART accession number: | SM01152 |
---|---|
Description: | - |
Interpro abstract (IPR003746): | This entry describes proteins of unknown function. Structures for two of these proteins, YggU from Escherichia coli and MTH637 from the archaea Methanobacterium thermoautotrophicum, have been determined; they have a core 2-layer alpha/beta structure consisting of beta(2)-loop-alpha-beta(2)-alpha [ (PUBMED:12975589) (PUBMED:11854485) ]. |
Family alignment: |
There are 8584 DUF167 domains in 8582 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)