The domain within your query sequence starts at position 32 and ends at position 108; the E-value for the DUF167 domain shown below is 3.17e-28.

PKGFVTIAIHAKPGSRQNAVTDLSTEAVGVAIAAPPSEGEANAELCRYLSKVLDLRKSDV
VLDKGGKSREKVVKLLA

DUF167

DUF167
SMART accession number:SM01152
Description: -
Interpro abstract (IPR003746):

This entry describes proteins of unknown function. Structures for two of these proteins, YggU from Escherichia coli and MTH637 from the archaea Methanobacterium thermoautotrophicum, have been determined; they have a core 2-layer alpha/beta structure consisting of beta(2)-loop-alpha-beta(2)-alpha [ (PUBMED:12975589) (PUBMED:11854485) ].

Family alignment:
View or

There are 8584 DUF167 domains in 8582 proteins in SMART's nrdb database.

Click on the following links for more information.