The domain within your query sequence starts at position 127 and ends at position 160; the E-value for the DUF1713 domain shown below is 3.23e-11.

QCKNVLKIRRRKMNHHKYRKLVKRTRFLRRKVRE

DUF1713

Mitochondrial domain of unknown function (DUF1713)
DUF1713
SMART accession number:SM01155
Description: This domain is found at the C terminal end of mitochondrial proteins of unknown function.
Interpro abstract (IPR013177):

This domain is found at the C-terminal end of mitochondrial mRNA-processing protein COX24, which is involved in the splicing of the COX1 mRNA [ (PUBMED:16339141) ]. It is also found in aurora-A kinase interacting protein (AIP) [ (PUBMED:17125467) ].

Family alignment:
View or

There are 1445 DUF1713 domains in 1445 proteins in SMART's nrdb database.

Click on the following links for more information.