The domain within your query sequence starts at position 52 and ends at position 162; the E-value for the DUF1716 domain shown below is 3.97e-61.

TADDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFM
ESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVV

DUF1716

Eukaryotic domain of unknown function (DUF1716)
DUF1716
SMART accession number:SM01156
Description: This domain is found in eukaryotic proteins. A human nuclear protein with this domain (Q8WYA6) is thought to have a role in apoptosis [(PUBMED:12659813)].
Interpro abstract (IPR013180):

This entry represents the N-terminal domain of the beta-catenin-like protein 1 (CTNNBL1). CTNNBL1 is a component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. In humans, it participates in AID/AICDA-mediated Ig class switching recombination (CSR) and may induce apoptosis [(PUBMED:12659813), (PUBMED:18722174)].

Family alignment:
View or

There are 1502 DUF1716 domains in 1499 proteins in SMART's nrdb database.

Click on the following links for more information.