The domain within your query sequence starts at position 435 and ends at position 671; the E-value for the DUF1741 domain shown below is 5.65e-139.
DKNLPCRPLVCAVLDLMVEFIVTHMMKEFPMDLYLRCVQVVHKLLCYQKKCRVRLHYTWR ELWSALINLLKFLMSNETVLLAKHNIFTLALMIVNLFNMFITYGDTFLPTPSSYDELYYE IIRMHQSFDNLYSMVLRLSTNAGQWKEAASKVTHALVNIRAIINHFNPKIESYAAVNHIS QLSEEQVLEVVRANYDTLTLKLQDGLDQYERYSEQHKEAAFFKELVRSISTNVRRNL
DUF1741 |
---|
SMART accession number: | SM01158 |
---|---|
Description: | This is a eukaryotic domain of unknown function. |
Interpro abstract (IPR013636): | This is a eukaryotic domain of unknown function. It can be found in the C terminus of the human C10orf76 protein. |
Family alignment: |
There are 1145 DUF1741 domains in 1145 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)