The domain within your query sequence starts at position 49 and ends at position 151; the E-value for the DUF1751 domain shown below is 4.14e-41.
PGYLFPPNFWIWTLATHGLMEQHVWDVAISLATVVVAGRLLEPLWGALELLIFFSVVNVS VGLLGALAYLLTYMASFNLVYLFTIRIHGALGFLGGVLVALKQ
DUF1751Eukaryotic integral membrane protein (DUF1751) |
---|
SMART accession number: | SM01160 |
---|---|
Description: | This domain is found in eukaryotic integral membrane proteins. Q12239 a Saccharomyces cerervisiae protein, has been shown to localise COP II vesicles [(PUBMED:14562095)]. |
Family alignment: |
There are 1423 DUF1751 domains in 1422 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Links (links to other resources describing this domain)