The domain within your query sequence starts at position 3 and ends at position 82; the E-value for the DUF1767 domain shown below is 1.36e-18.

FILFNRYLSDEGVEACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGGKVEKLEGP
CVLQIQKVRNVAAPKDNEES

DUF1767

DUF1767
SMART accession number:SM01161
Description: Eukaryotic domain of unknown function. This domain is found to the N-terminus of the nucleic acid binding domain.
Interpro abstract (IPR033472):

This is an eukaryotic domain of unknown function. This domain is found to the N terminus of the nucleic acid binding domain in RecQ mediated genome instability protein (RMI) [ (PUBMED:18923082) ].

Family alignment:
View or

There are 1940 DUF1767 domains in 1938 proteins in SMART's nrdb database.

Click on the following links for more information.