The domain within your query sequence starts at position 1526 and ends at position 1591; the E-value for the DUF1771 domain shown below is 1.88e-21.

EYDDYRAEAFLHQQKRMECYSKAKEAYRMGKKNVATFYAQQGSLHEQKMKEANHLAAVEI
FEKVNA

DUF1771

DUF1771
SMART accession number:SM01162
Description: This domain is always found adjacent to SMR (SM00463).
Interpro abstract (IPR013899):

This domain is almost always found adjacent to IPR002625.

Family alignment:
View or

There are 2910 DUF1771 domains in 2907 proteins in SMART's nrdb database.

Click on the following links for more information.