The domain within your query sequence starts at position 863 and ends at position 1008; the E-value for the DUF1866 domain shown below is 1.04e-73.

EVEVQEVDVGARERVFQEVSSVQGPLDATVVVNLQSPTLEEKNEFPEDLRTELMQTLGNY
GTIILVRINQGQMLVTFADSHSALSVLDVDGMKVKGRAVKIRPKTKDWLEGLREELLRKR
DSMAPVSPTANSCLLEENFDFSSLDY

DUF1866

DUF1866
SMART accession number:SM01165
Description: This domain, found in Synaptojanin, has no known function.
Interpro abstract (IPR015047):

This domain can be found in Synaptojanin.

Synaptojanin is a phosphoinositide phosphatase known to play an important role in vesicle recycling by promoting the uncoating of clathrin following synaptic vesicle uptake [(PUBMED:10931870), (PUBMED:27559170)].

Family alignment:
View or

There are 1216 DUF1866 domains in 1215 proteins in SMART's nrdb database.

Click on the following links for more information.