The domain within your query sequence starts at position 4 and ends at position 68; the E-value for the DUF1899 domain shown below is 1.6e-33.
QVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLP LGKTG
DUF1899 |
---|
SMART accession number: | SM01166 |
---|---|
Description: | This set of domains is found in various eukaryotic proteins. Function is unknown. |
Interpro abstract (IPR015048): | Coronins are evoluntionarily conserved proteins, mainly involved in actin cytoskeleton organisation. Typically Coronins contain a DUF1899 domain, a series of WD40 repeats, a DUF1900 domain ( IPR015049 ) and a C-terminal coiled-coil domain [ (PUBMED:18925370) ]. This entry represents the N-terminal DUF1899 domain. A putative actin binding site just downstream of a phosphoserine modification site is proposed to be located in this domain [ (PUBMED:12673016) (PUBMED:16027158) (PUBMED:18925370) ]. Proteins with this domain include most of the Coronin homologues (besides Coronin 7 [ (PUBMED:18925371) ]) and Villidin from Dictyostelium discoideum. |
Family alignment: |
There are 4857 DUF1899 domains in 4244 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)