The domain within your query sequence starts at position 5 and ends at position 69; the E-value for the DUF1899 domain shown below is 2.89e-31.

PQYRSSKFRNVYGKAANREHCFDGIPITKNVHDNHFCAVNARFLAIVTESAGGGSFLVIP
LEQTG

DUF1899

DUF1899
SMART accession number:SM01166
Description: This set of domains is found in various eukaryotic proteins. Function is unknown.
Interpro abstract (IPR015048):

Coronins are evoluntionarily conserved proteins, mainly involved in actin cytoskeleton organisation. Typically Coronins contain a DUF1899 domain, a series of WD40 repeats, a DUF1900 domain ( IPR015049 ) and a C-terminal coiled-coil domain [ (PUBMED:18925370) ].

This entry represents the N-terminal DUF1899 domain. A putative actin binding site just downstream of a phosphoserine modification site is proposed to be located in this domain [ (PUBMED:12673016) (PUBMED:16027158) (PUBMED:18925370) ].

Proteins with this domain include most of the Coronin homologues (besides Coronin 7 [ (PUBMED:18925371) ]) and Villidin from Dictyostelium discoideum.

Family alignment:
View or

There are 4857 DUF1899 domains in 4244 proteins in SMART's nrdb database.

Click on the following links for more information.