The domain within your query sequence starts at position 261 and ends at position 397; the E-value for the DUF1900 domain shown below is 9.15e-84.
PLTEEDLDGSSGVLFPFFDSDTSMLYIVGKGDGNIRYYEVSMEKPHLTYLTEYRSYNPQK GIGIMPKRGLDVSSCEIFRFYKLITTKSLIEPVSMIVPRRSESYQEDIYPPTAAAQPSLT AHEWLSGMNRGPIMMSL
DUF1900 |
---|
SMART accession number: | SM01167 |
---|---|
Description: | This domain is predominantly found in the structural protein coronin, and is duplicated in some sequences. It has no known function [(PUBMED:16172398)]. |
Family alignment: |
There are 5206 DUF1900 domains in 4443 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)